Rakta dhatu: Difference between revisions

Anagha (talk | contribs)
Agnivesha (talk | contribs)
No edit summary
 
(37 intermediate revisions by 3 users not shown)
Line 1: Line 1:
 
{{CiteButton}}
Rakta dhatu is a body component similar to blood tissue. Its important function is to give life or maintain vitality(jivana). Body fluid (rasa dhatu) after acquiring  ‘red’ color is termed as “rakta”(blood). (SAT-B.429)
{{#seo:
|title=Rakta dhatu
|titlemode=append
|keywords=Rakta dhatu in ayurveda,Rakta dhatu meaning,Rakta dhatu,Charak Samhita,Rakta dhatu ayurveda,Panchabhautika constitution and properties,Formation and metabolism of rakta dhatu,rakta dhatu Location,Metabolic byproducts and waste products (Upadhatu and mala),Characteristics of pure blood,Channels of transportation and transformation of rakta dhatu (raktavahasrotas),Layer of blood tissue (raktadharakala),role of rakta dhatu in the formation of body organs,rakta dhatu Importance in diagnosis,Role of rakta dhatu as vitiated factor in disease,Principles of management of diseases of rakta dhatu,Best herbs in management (agryasamgraha)
|description=Rakta dhatu is a body component similar to blood tissue
|image=http://www.carakasamhitaonline.com/resources/assets/ogimgs.jpg
|image_alt=carak samhita
|type=article
}}
<p style="text-align:justify;">Rakta dhatu is a body component similar to blood tissue. Its important function is to give life or maintain vitality(jivana). Body fluid (rasa dhatu) after acquiring  ‘red’ color is termed as “rakta”(blood).<ref>Available from http://namstp.ayush.gov.in/#/sat</ref>(SAT-B.429) </p>


{{Infobox
{{Infobox
Line 10: Line 19:


|label2 = Authors
|label2 = Authors
|data2 = Deole Y.S.,Anagha S.   
|data2 = [[Yogesh Deole|Deole Y.S.]], Anagha S.   
|label3 = Reviewer
|label3 = Reviewer
|data3 = Basisht G.
|data3 = [[Gopal Basisht|Basisht G.]]


|label4 = Affiliation
|label4 = Affiliation
Line 20: Line 29:
|data5 = carakasamhita@gmail.com
|data5 = carakasamhita@gmail.com


|label6 = Date of publication:
|label6 = Publisher
|data6 = June 18, 2020
|data6 = [[Charak Samhita Research, Training and Development Centre]], I.T.R.A., Jamnagar, India
 
|label7 = Date of publication:
|data7 = June 18, 2020
|label8 = DOI
|data8 = [https://doi.org/10.47468/CSNE.2020.e01.s09.014 10.47468/CSNE.2020.e01.s09.014]
}}
}}
==Etymology and derivation==
==Etymology and derivation==


The word ‘Rakta’ is derived from Sanskrit root “ranj”, meaning–to dye or colour, to affect or move, to excite/glad/charm/delight.  
The word ‘Rakta’ is derived from Sanskrit root “ranj”, meaning–to dye or colour, to affect or move, to excite/glad/charm/delight.<ref>Monier Williams (1899), “रक्त”, in A Sanskrit–English Dictionary, new edition, Oxford: At the Clarendon Press, OCLC 458052227, page 0861.</ref>
==Synonyms ==
==Synonyms ==
Shonita, rudhira, asrik, astra,lohita,kshataja
Shonita, rudhira, asrik, astra,lohita,kshataja


*'''Shonita''': The term is derived from ‘shona’ meaning red color. The term is also applied to denote the female genetic prototype.  
*'''Shonita''': The term is derived from ‘shona’ meaning red color. The term is also applied to denote the female genetic prototype.<ref>Available from https://www.wisdomlib.org/definition/shonita</ref>


*'''Rudhira''': The term is derived from root ‘rudh’ meaning to stop or hold. The blood tissue sustains the life of human beings, hence it is called ‘rudhira’’.  [Su. Sam. Sutra Sthana 14/39]
*'''Rudhira''': The term is derived from root ‘rudh’ meaning to stop or hold. The blood tissue sustains the life of human beings, hence it is called ‘rudhira’’.  [Su. Sam. Sutra Sthana 14/39]


*'''Lohita''': The term indicates the coppery red color of blood. [Su. Sam. Sutra Sthana 14/5]
*'''Lohita''': The term indicates the coppery red color of blood. [Su. Sa. Sutra Sthana 14/5]


*'''Asrik/Asra''': The term is derived from Sanskrit root ‘ashukshepane, srijvisarge'. It means to get ejected or expelled out. This synonym is used in the context of excessive bleeding. E.g.asrigdara(menorrhagia), asrapitta/raktapitta(bleeding disorders)
*'''Asrik/Asra''': The term is derived from Sanskrit root ‘ashukshepane, srijvisarge'. It means to get ejected or expelled out. This synonym is used in the context of excessive bleeding. E.g.menorrhagia(asrigdara), bleeding disorders(asrapitta/raktapitta)


*'''Kshataja''': It means that which originates from trauma (kshata) or wound/ulcer (vrana).
*'''Kshataja''': It means that which originates from trauma (kshata) or wound/ulcer (vrana).
Line 52: Line 66:
The Rakta dhatu is constituted with the dominance of [[agni mahabhuta]] and all other [[mahabhuta]].  It possesses properties like peculiar smell (vistrata), liquidity(dravata), red color(raga), pulsation(spandanam) and lightness to get circulated (laghuta) due to [[Prithvi]],[[ jala]],[[teja]], [[vayu]] and [[akasha mahabhuta]] are spectively. [Su.Sa. Sutra Sthana 14/9]
The Rakta dhatu is constituted with the dominance of [[agni mahabhuta]] and all other [[mahabhuta]].  It possesses properties like peculiar smell (vistrata), liquidity(dravata), red color(raga), pulsation(spandanam) and lightness to get circulated (laghuta) due to [[Prithvi]],[[ jala]],[[teja]], [[vayu]] and [[akasha mahabhuta]] are spectively. [Su.Sa. Sutra Sthana 14/9]


Rakta dhatu is neither too hot nor too cold(anushna-sheeta), sweet (madhura), unctuous (snigdha), red(rakta), heavy(guru), with peculiar smell (vistra).It can get affected by the same substances that provoke [[pitta dosha]].[Su. Sam. Sutra Sthana 21/17]
Rakta dhatu is neither too hot nor too cold(anushna-sheeta), sweet (madhura), unctuous (snigdha), red(rakta), heavy(guru), with peculiar smell (vistra).It can get affected by the same substances that provoke [[pitta dosha]].[Su. Sa. Sutra Sthana 21/17]


==Formation and metabolism of rakta dhatu==
==Formation and metabolism of rakta dhatu==
Line 61: Line 75:


===Location:===
===Location:===
As per contemporary theories, in the early stages of embryogenesis, blood formation (hematopoiesis) occurs in blood islands. These are aggregates of blood cells in the yolk sac.  As development progresses, blood formation occurs in the spleen, liver, and lymph nodes. These are the primary site until the first three months of gestation. In the seventh month of gestation, after the development of bone marrow, it eventually becomes the major site of formation of most of the blood cells for the entire organism. Hematopoietic stem cells (HSCs) in the bone marrow give rise to all of the different mature blood cell types and tissues. In children, hematopoiesis occurs in the marrow of the long bones such as the femur and tibia. In adults, it occurs mainly in the pelvis, cranium, vertebrae, and sternum.  
As per contemporary theories, in the early stages of embryogenesis, blood formation (hematopoiesis) occurs in blood islands. These are aggregates of blood cells in the yolk sac.  As development progresses, blood formation occurs in the spleen, liver, and lymph nodes. These are the primary site until the first three months of gestation. In the seventh month of gestation, after the development of bone marrow, it eventually becomes the major site of formation of most of the blood cells for the entire organism.<ref>Birbrair, Alexander; Frenette, Paul S. (1 March 2016). "Niche heterogeneity in the bone marrow". Annals of the New York Academy of Sciences. 1370 (1): 82–96. Bibcode:2016NYASA1370...82B. doi:10.1111/nyas.13016. ISSN 1749-6632. PMC 4938003. PMID 27015419.</ref> Hematopoietic stem cells (HSCs) in the bone marrow give rise to all of the different mature blood cell types and tissues. In children, hematopoiesis occurs in the marrow of the long bones such as the femur and tibia. In adults, it occurs mainly in the pelvis, cranium, vertebrae, and sternum.<ref>Fernández KS, de Alarcón PA (December 2013). "Development of the hematopoietic system and disorders of hematopoiesis that present during infancy and early childhood". Pediatric Clinics of North America. 60 (6): 1273–89. doi:10.1016/j.pcl.2013.08.002. PMID 24237971</ref>
Sushruta highlighted the presence of adipose tissue ([[meda dhatu]]) in the medulla of bone. The adipose tissue ([[meda dhatu]])  present in long and big bones is known as marrow ([[majja]]). That present inside the small bones is termed as red marrow (saraktameda). [Su. Sa. Sharira Sthana 4/13]
Sushruta highlighted the presence of adipose tissue ([[meda dhatu]]) in the medulla of bone. The adipose tissue ([[meda dhatu]])  present in long and big bones is known as marrow ([[majja]]). That present inside the small bones is termed as red marrow (saraktameda). [Su. Sa. Sharira Sthana 4/13]


This unctuous portion in the bone marrow can be linked to the formation of blood as per current views.
This unctuous portion in the bone marrow can be linked to the formation of blood as per current views.


The liver acts as the major blood reservoir.  It stores about 450 milliliters or almost 10 percent of the body's total blood volume. This capacity can increase up to 1 litre in certain cases due to the expanding capacity of the liver. It synthesizes some proteins including coagulation factors I (fibrinogen), II (prothrombin), V, VII, VIII, IX, X, XI, XII, XIII, as well as protein C, protein S and antithrombin. All of these play important roles in blood physiology. Moreover, the liver is a major site of production for thrombopoietin, a glycoprotein hormone that regulates the production of platelets by the bone marrow. The liver plays a major role in glucose, protein, and lipids present in the blood. It also purifies and protects blood from harmful toxins, metabolites, and heavy metals.  
The liver acts as the major blood reservoir.  It stores about 450 milliliters or almost 10 percent of the body's total blood volume. This capacity can increase up to 1 litre in certain cases due to the expanding capacity of the liver. It synthesizes some proteins including coagulation factors I (fibrinogen), II (prothrombin), V, VII, VIII, IX, X, XI, XII, XIII, as well as protein C, protein S and antithrombin. All of these play important roles in blood physiology. Moreover, the liver is a major site of production for thrombopoietin, a glycoprotein hormone that regulates the production of platelets by the bone marrow. The liver plays a major role in glucose, protein, and lipids present in the blood. It also purifies and protects blood from harmful toxins, metabolites, and heavy metals.<ref>Available from https://en.wikipedia.org/wiki/Liver accessed on 15/06/2020</ref>


Thus, bone marrow is the site of formation of blood cells; whereas the liver is the major site in maturation of blood cells and maintaining the physiological status of blood tissue.
Thus, bone marrow is the site of formation of blood cells; whereas the liver is the major site in maturation of blood cells and maintaining the physiological status of blood tissue.
Line 73: Line 87:


During the process of metabolism and formation of rakta dhatu, tendons(kandara) and veins(sira) are formed as the metabolic byproducts(upadhatu).[Cha. Sa.[[Chikitsa Sthana]] 15/17]. Sharangadhara opines menstrual blood([[artava]]) as the metabolic by-product.  
During the process of metabolism and formation of rakta dhatu, tendons(kandara) and veins(sira) are formed as the metabolic byproducts(upadhatu).[Cha. Sa.[[Chikitsa Sthana]] 15/17]. Sharangadhara opines menstrual blood([[artava]]) as the metabolic by-product.  
[Sharangadhara Sa. Purvakhanda chapter 5]
[Sha. Sa. Purva khanda chapter 5]


Various pigments and acidic secretions are formed as waste during this process. These are termed as malarupa [[pitta]].[Cha.Sa. Sutra Sthana 15/5]
Various pigments and acidic secretions are formed as waste during this process. These are termed as malarupa [[pitta]].[Cha.Sa. Sutra Sthana 15/5]
Line 151: Line 165:
*sour and pungent food
*sour and pungent food


*kulatha (Dolichosbiflorus Linn.)  
*Dolichosbiflorus Linn. (kulatha)  


*masha (Phaseolus mungo Linn.)
*Phaseolus mungo Linn. (masha)


*nishpava (Dolichos lablab Linn.)
*Dolichos lablab Linn. (nishpava)


*tila taila (Sesamum indicum Linn. oils)
*Sesamum indicum Linn. oil (tila taila)


*pindalu (Randiauliginosa DC.)
*Randiauliginosa DC.(pindalu)


*radish and all green (leafy) vegetables
*radish and all green (leafy) vegetables
Line 202: Line 216:


===Abnormal states===
===Abnormal states===
The physician should diagnose the quantitative and qualitative imbalance of raktaby observing various features manifested due to decrease(kshaya) and increase(vridhi).
 
Clinical featuresof decrease:  
The physician should diagnose the quantitative and qualitative imbalance of rakta by observing various features manifested due to decrease(kshaya) and increase(vridhi).
Symptoms of decrease of rakta are roughness of skin,cracks, dullness and dryness ofskin.[Cha. Sa. Sutra Sthana 17/65].  In addition, craving for sour food, liking for cold substances, looseness of blood vessels is also observed.[Su. Sa. Sutra Sthana 15/9].  
 
Clinical features of increase:  
===Clinical features of decrease:===
Reddish discolouration of eyes and other body parts and fullness of veins are considered as the signs of increase of rakta dhatu. [Su. Sa. Sutra Sthana 15/10].  
 
Disorders due to blood vitiation:  
*Symptoms of decrease of rakta are roughness of skin, cracks, dullness, and dryness of skin.[Cha. Sa. [[Sutra Sthana]] 17/65].  In addition, craving for sour food, liking for cold substances, looseness of blood vessels is also observed.[Su. Sa. Sutra Sthana 15/9].  
Following disorders are caused by blood vitiation:  
 
===Clinical features of increase:===
*Reddish discolouration of eyes and other body parts and fullness of veins are considered as the signs of increase of rakta dhatu. [Su. Sa. Sutra Sthana 15/10].  
 
===Disorders due to blood vitiation:===
 
'''Following disorders are caused by blood vitiation:'''
 
Stomatitis, redness in eyes, foul smell in nose and mouth, gulma (abdominal lump),  gingivitis (upakusha), erysipelas, bleeding disorder, sleepiness, abscess, hematuria, menorrhagia, vatarakta, discoloration of skin, loss of digestive power, thirst, heaviness in body, pyrexia, extreme debility, anorexia, headache, burning sensation after meals, bitter and sour eructation, physical and mental exhaustion, excessive anger, state of confusion, saline taste in mouth, sweating, fetid odor in body, narcosis, tremors, decreased voice, drowsiness, excessive sleep and feeling of darkness, itching, pustules, patches, boils, leprosy, thick skin, etc.  
Stomatitis, redness in eyes, foul smell in nose and mouth, gulma (abdominal lump),  gingivitis (upakusha), erysipelas, bleeding disorder, sleepiness, abscess, hematuria, menorrhagia, vatarakta, discoloration of skin, loss of digestive power, thirst, heaviness in body, pyrexia, extreme debility, anorexia, headache, burning sensation after meals, bitter and sour eructation, physical and mental exhaustion, excessive anger, state of confusion, saline taste in mouth, sweating, fetid odor in body, narcosis, tremors, decreased voice, drowsiness, excessive sleep and feeling of darkness, itching, pustules, patches, boils, leprosy, thick skin, etc.  
The diseases, which, in spite of being curable, are not alleviated after treatment with any of six therapies like cold-hot, unctuous-rough etc. should be considered as caused by impure blood. [Cha. Sa. Sutra Sthana 24/11-17]
 
Clinical features of vitiation of channels of transportation and transformation of blood (raktavahasrotasa):
The diseases, which, in spite of being curable, are not alleviated after treatment with any of six therapies like cold-hot, unctuous-rough etc. should be considered as caused by impure blood. [Cha. Sa. [[Sutra Sthana]] 24/11-17]
Following clinical conditions are observed due to affection of channels of transportation and transformation of blood:  
 
Skin diseases (kushtha), erysipelas (visarpa), furuncles (pidaka),  bleeding disorders(raktapitta), asrigdara(menorrhagia), inflammation of anus, penis, oral cavity, splenic disorders (pliha), abdominal lump (gulma), abscess (vidradhi), blue mole (nilika), jaundice (kamala), freckles/blemish (vyanga), portwine mark (piplu), black mole of the size of sesame seed (tilakalaka), ringworm (dadru), dermatitis (charmadala), leukoderma (shvitra), scabies (pama), urticaria (kotha), and circular erythema (asra mandala).[Cha. Sa. Sutra Sthana 28/11-13]
===Clinical features of vitiation of channels of transportation and transformation of blood (raktavahasrotasa):===
Role of rakta dhatu as vitiated factor in disease:
 
Rakta playsa major role in pathogenesis of following diseases:
'''Following clinical conditions are observed due to affection of channels of transportation and transformation of blood:  
Bleeding disorders(raktapitta) [Cha. Sa.   ChikitsaSthana 4/7-9]
'''
Disease due to vata and rakta (vatarakta) [Cha. Sa.   ChikitsaSthana 29/10]
 
erysipelas(visarpa) [Cha. Sa. Sutra Sthana 18/23] [Cha. Sa.   ChikitsaSthana 21/15]
Skin diseases (kushtha), erysipelas (visarpa), furuncles (pidaka),  bleeding disorders(raktapitta), asrigdara(menorrhagia), inflammation of anus, penis, oral cavity, splenic disorders (pliha), abdominal lump (gulma), abscess (vidradhi), blue mole (nilika), jaundice (kamala), freckles/blemish (vyanga), portwine mark (piplu), black mole of the size of sesame seed (tilakalaka), ringworm (dadru), dermatitis (charmadala), leukoderma (shvitra), scabies (pama), urticaria (kotha), and circular erythema (asra mandala).[Cha. Sa. [[Sutra Sthana]] 28/11-13]
Intoxication(mada), syncope (moorcha), coma(sanyasa) [Cha. Sa. Sutra Sthana 24/25] skin diseases(kushtha) [Cha. Sa.NidanaSthana 5/3]
 
Obstinate urinary disorders including diabetes(prameha) [Cha. Sa.NidanaSthana 4/7]
===Role of rakta dhatu as vitiated factor in disease:===
Sub- types of some diseases indicate the major role of rakta in their pathogenesis:
 
Obstinate urinary disorders (raktameha) [Cha. Sa. NidanaSthana 4/32]
Rakta plays a major role in the pathogenesis of the following diseases:
Micro-organisms originating in blood (shonitajaKrimi)[Cha. Sa. Vimana Sthana 7/11]
 
Abdominal lump due to blood (raktagulma)[Cha. Sa. ChikitsaSthana 5/18]
*Bleeding disorders(raktapitta) [Cha.Sa.[[Chikitsa Sthana]] 4/7-9]
Diarrhoea with blood (raktatisara)[Cha. Sa.ChikitsaSthana 19/70]
 
Abscess with blood (raktavidradhi) [Su. Sam. NidanaSthana 9/14,26]
*Disease due to vata and rakta (vatarakta) [Cha. Sa. [[Chikitsa Sthana]] 29/10]
In case of fever (jwara), when the vitiated dosha are located in the rakta dhatu, following clinical features are observed: Increase in body temperature, eruptions, thirst, frequent spitting mixed with blood burning sensation, discoloration, giddiness, intoxication and incoherent speech. [Cha. Sa.   ChikitsaSthana 3/77]
 
In fever (jwara) caused by trauma(abhighata),vitiated vata affects predominantly rakta (blood). This leads to clinical features like discomfort, swelling, discoloration and pain.[Cha. Sa. ChikitsaSthana 3/114].  
*erysipelas(visarpa) [Cha. Sa. Sutra Sthana 18/23] [Cha. Sa. [[Chikitsa Sthana]] 21/15]
In all other exogenous causative injuries like poison (visha) etc, rakta dhatu is predominantly affected. In such cases, it has both diagnostic and therapeutic importance.
 
*Intoxication(mada), syncope (moorcha), coma(sanyasa) [Cha. Sa. [[Sutra Sthana]] 24/25] skin diseases(kushtha) [Cha. Sa.[[Nidana Sthana]] 5/3]
 
*Obstinate urinary disorders including diabetes(prameha) [Cha. Sa.[[Nidana Sthana]] 4/7]
 
Subtypes of some diseases indicate the major role of rakta in their pathogenesis:
 
*Obstinate urinary disorders (raktameha) [Cha. Sa. [[Nidana Sthana]] 4/32]
 
*Micro-organisms originating in blood (shonitajaKrimi)[Cha.Sa.[[Vimana Sthana]] 7/11]
 
*Abdominal lump due to blood (raktagulma)[Cha. Sa. [[Chikitsa Sthana]] 5/18]
 
*Diarrhoea with blood (raktatisara)[Cha. Sa.[[Chikitsa Sthana]] 19/70]
 
*Abscess with blood (raktavidradhi) [Su. Sam. Nidana Sthana 9/14,26]
 
*In case of fever (jwara), when the vitiated [[dosha]] are located in the rakta dhatu, following clinical features are observed: Increase in body temperature, eruptions, thirst, frequent spitting mixed with blood burning sensation, discoloration, giddiness, intoxication, and incoherent speech. [Cha. Sa. [[Chikitsa Sthana]] 3/77]
 
*In fever (jwara) caused by trauma(abhighata),vitiated vata affects predominantly rakta (blood). This leads to clinical features like discomfort, swelling, discoloration, and pain.[Cha. Sa. [[Chikitsa Sthana]] 3/114].  
 
*In all other exogenous causative injuries like poison (visha) etc, rakta dhatu is predominantly affected. In such cases, it has both diagnostic and therapeutic importance.
 
==Importance in preservation of health and prevention ==
==Importance in preservation of health and prevention ==
The pure blood provides the individual with strength, complexion, happiness, and life. [Cha. Sa. Sutra Sthana 28/4]. It is the fundamental source of vitality and life. [Su. Sam. Sutra Sthana 14/44]
The pure blood provides the individual with strength, complexion, happiness, and life. [Cha. Sa. [[Sutra Sthana]] 28/4].  
 
It is the fundamental source of vitality and life. [Su. Sam. Sutra Sthana 14/44]
 
==Principles of management of diseases of rakta dhatu==
==Principles of management of diseases of rakta dhatu==
 The principles of management for disorders of raktaare mentioned as below [Cha. Sa. Sutra Sthana 24/18].


If there is excessive vitiation of rakta dhatu, then purification procedures are indicated. This includes therapeutic purgation (virechana) and bloodletting (raktamokshana) after considering strength of the patient.
*The principles of management for disorders of rakta are mentioned as below [Cha. Sa.[[Sutra Sthana]] 24/18].


In case of mild to moderate severity of disease and in patients with low strength, pacification therapies (shamana) is indicated. This includes therapeutic fasting (upavasa) and management on the lines of bleeding disorders (raktapitta).  
If there is excessive vitiation of rakta dhatu, then purification procedures are indicated. This includes therapeutic purgation ([[virechana]]) and bloodletting ([[rakta mokshana]]) after considering the strength of the patient.


In case of fever (jwara), the dosha located in raktadhatu are treated with pouring of medicated liquids (seka) and ointment application (pradeha).[Cha. Sa. ChikitsaSthana 3/316].
In the case of mild to moderate severity of disease and in patients with low strength, pacification therapies (shamana) is indicated.  This includes therapeutic fasting (upavasa) and management on the lines of bleeding disorders (raktapitta).  
 In case of poisoning, the spread of toxins is arrested by applying coolingexternal application (pradeha  and alepa) and poring medicated liquids (seka). [Cha. Sa. ChikitsaSthana 23/42-43] It shows pacifying actions on vitiated rakta and pitta. [Su. Sa. Sutra Sthana 18/3]


Best herbs in management (agryasamgraha):
*In case of fever (jwara), the dosha located in rakta dhatu are treated with pouring of medicated liquids (seka) and ointment application (pradeha).[Cha. Sa. [[Chikitsa Sthana]] 3/316].
Some food items and herbs have excellent action on blood as follows:[Cha. Sa. Sutra Sthana 25/40].


Name Pharmacological effect 
*In case of poisoning, the spread of toxins is arrested by applying cooling external application (pradeha and alepa) and poring medicated liquids (seka). [Cha. Sa. [[Chikitsa Sthana ]]23/42-43] It shows pacifying actions on vitiated rakta and [[pitta]]. [Su. Sa. Sutra Sthana 18/3]
Goat milk (ajaksheera) Pacifying raktapitta (bleeding disorders) (raktapittaprashamana)
Ananta (Hemidesmus indicus R.B.)or Indian sarsaparilla Astringent effect, pacifying raktapitta (Sangrahikaraktapittaprashamana)
Pollens of utpala (Nymphaca alba Linn.), kumuda (a variety of utpala) and padma (Nelumbo nucifera gaertn.) or pollen of blue and white water lilies Astringent effect, alleviating raktapitta (sangrahikaraktapittaprashamana)
Bark of kutaja (Holarrhenaantidyscenterica wall.) or kurchi bark Among astringent and desiccant of kapha, pitta and the blood (shlesma pitta raktasangrahikopsosananam).
Fruit of kashmari (Gmelina arboria) or fruit of white teak Causing haemostasis and curing raktapitta (Raktasangrahikaraktapittaprashamana)
Guduchi (Tinosporacordifoliamiers) or amrita Act as astringent, curative of vata, promotes digestion, curative of vitiation of kapha and blood (sangrahikavataharadipaniyashleshmashonitavibandhaprashamana).
Priyangu [Callicarpa macrophylla Vahi.] or the perfumed cherry Alleviate the plethoric condition of blood and pitta (shonitapittatiyogaprashamana)


Physiological effect of various tastes on blood:
===Best herbs in management (agryasamgraha):===
The substances with predominant tastes (rasa) produce physiological effect on rakta dhatu as shown below.[Cha. Sa. Sutra Sthana 26/43]
Some food items and herbs have excellent action on blood as follows: [Cha. Sa. [[Sutra Sthana]] 25/40].
Rasa (taste) Effect
{| class="wikitable"
Sour(amla rasa) Vitiates blood (raktamdushayati)
|-
Salty(lavana rasa) Increases volume(raktamvardhayati)
! Name  !!Pharmacological effect 
Pungent (katurasa ) Breaks the blood clots/anti-coagulant (shonitasanghatambhinatti)  
|-
Bitter (tiktarasa) Depletes the quantity of blood by absorbing fluid portion(raktamshoshayati)
|Goat milk (ajaksheera) || Pacifying raktapitta (bleeding disorders) (raktapittaprashamana)
Astringent(kashaya rasa) Pacifies vitiated blood (Raktaprashamana)
|-
|Ananta (Hemidesmus indicus R.B.)or Indian sarsaparilla ||Astringent effect, pacifying raktapitta (Sangrahikaraktapittaprashamana)
|-
|Pollens of utpala (Nymphaca alba Linn.), kumuda (a variety of utpala) and padma (Nelumbo nucifera gaertn.) or pollen of blue and white water lilies || Astringent effect, alleviating raktapitta (sangrahikaraktapittaprashamana)
|-
|Bark of kutaja (Holarrhenaantidyscenterica wall.) or kurchi bark || Among astringent and desiccant of kapha, pitta and the blood (shlesma pitta raktasangrahikopsosananam).
|-
|Fruit of kashmari (Gmelina arboria) or fruit of white teak || Causing haemostasis and curing raktapitta (Raktasangrahikaraktapittaprashamana)
|-
|Guduchi (Tinosporacordifoliamiers) or amrita || Act as astringent, curative of vata, promotes digestion, curative of vitiation of kapha and blood (sangrahikavataharadipaniyashleshmashonitavibandhaprashamana).
|-
| Priyangu [Callicarpa macrophylla Vahi.] or the perfumed cherry || Alleviate the plethoric condition of blood and pitta (shonitapittatiyogaprashamana)
|}


The above factors are used in diagnosis as well as treatment. E.g. Sour substances are known to vitiate blood, hence the patients with disorders due to vitiation of blood are advised to avoid sour substance. Instead, they are advised to consume bitter and astringent substances.  The substances with pungent taste can be used to prevent coagulation.
===Physiological effect of various tastes on blood: ===
===Contemporary approach ===
The substances with predominant tastes (rasa) produce physiological effects on rakta dhatu as shown below.[Cha. Sa. [[Sutra Sthana]] 26/43]
In contemporary physiology, red coloured fraction of blood is considered as rakta dhatu. The colourless fluid (plasma) is considered as rasa dhatu. Thus, rasa and rakta together form “blood”. The red fraction orred blood corpuscles are referred as rakta dhatu in this article.  
{| class="wikitable"
Composition:  
|-
Blood is a complex liquid tissue composed of different types of cells. The plasma which represents the matrix of this tissue constitutes over 55% of it. Formed elements which are suspended in the liquid matrix constitute over 45% of blood, these comprise of erythrocytes,leucocytes and platelets. The characteristic color of blood is due to the erythrocytes present in it. These cells are formed in the red born marrow and they survive for about 80 days in circulation and then disintegrate. Their debris are removed from the blood by liver and spleen. Ranjaka pitta which gives color to rakta may be considered as the ayurvedic analogue of the red cobalt linked enzyme B12 present in the liver.  
! Rasa (taste)  !!Effect
Color:  
|-
| Sour(amla rasa) || Vitiates blood (raktam dushayati)
|-
| Salty(lavana rasa) || Increases volume(raktam vardhayati)
|-
| Pungent (katurasa ) || Breaks the blood clots/anti-coagulant (shonitasanghatam bhinatti)
|-
|Bitter (tiktarasa)|| Depletes the quantity of blood by absorbing fluid portion(raktam shoshayati)
|-
|Astringent(kashaya rasa)|| Pacifies vitiated blood (Raktaprashamana)
|}
 
The above factors are used in diagnosis as well as treatment.  
 
E.g. Sour substances are known to vitiate blood, hence the patients with disorders due to vitiation of blood are advised to avoid sour substance. Instead, they are advised to consume bitter and astringent substances.  The substances with pungent taste can be used to prevent coagulation.
 
==Contemporary approach ==
In contemporary physiology, red coloured fraction of blood is considered as rakta dhatu. The colourless fluid (plasma) is considered as rasa dhatu. Thus, rasa and rakta together form “blood”. The red fraction or red blood corpuscles are referred to as rakta dhatu in this article.  
===Composition:===
Blood is a complex liquid tissue composed of different types of cells. The plasma which represents the matrix of this tissue constitutes over 55% of it. Formed elements that are suspended in the liquid matrix constitute over 45% of blood, these comprise of erythrocytes,leukocytes, and platelets.<ref name=dwaraka>Dwarkanath C. Introduction to Kayachikitsa. Chaukhambha Orientalia. Varanasi; 1996. Third edition.pg.343</ref> The characteristic color of blood is due to the erythrocytes present in it. These cells are formed in the red born marrow and they survive for about 80 days in circulation and then disintegrate. Their debris is removed from the blood by liver and spleen.<ref name=dwaraka></ref> Ranjaka pitta which gives color to rakta may be considered as the ayurvedic analogue of the red cobalt linked enzyme B12 present in the liver.<ref> Dwarkanath C. Introduction to Kayachikitsa. Chaukhambha Orientalia. Varanasi; 1996. Third edition.pg.330</ref>
 
===Color: ===
The red color in blood is due to hemochrome present in the protein (hemoglobin). This is responsible for oxygen transport. Different groups of organisms use different proteins.
The red color in blood is due to hemochrome present in the protein (hemoglobin). This is responsible for oxygen transport. Different groups of organisms use different proteins.
Quantity:  
 
===Quantity:===
Blood accounts for 7% of the human body weight. The average adult has a blood volume of roughly 5 litres.  
Blood accounts for 7% of the human body weight. The average adult has a blood volume of roughly 5 litres.  
Functions:  
===Functions: ===
The blood has important role in physiology of cardiovascular system andlymphatic system.  
The blood has an important role in the physiology of the cardiovascular system and lymphatic system.  
 
It carries important functions as below:  
It carries important functions as below:  
Supply of oxygen to tissues (bound to hemoglobin, which is carried in red cells)
 
Supply of nutrients such as glucose, amino acids, and fatty acids (dissolved in the blood or bound to plasma proteins (e.g., blood lipids)
*Supply of oxygen to tissues (bound to hemoglobin, which is carried in red cells)
Removal of waste such as carbon dioxide, urea, and lactic acid
 
Immunological functions, including circulation of white blood cells, and detection of foreign material by antibodies
*Supply of nutrients such as glucose, amino acids, and fatty acids (dissolved in the blood or bound to plasma proteins (e.g., blood lipids)
Coagulation, the response to a broken blood vessel, the conversion of blood from a liquid to a semisolid gel to stop bleeding
 
Messenger functions, including the transport of hormones and the signaling of tissue damage
*Removal of waste such as carbon dioxide, urea, and lactic acid
Regulation of core body temperature
 
Hydraulic functions
*Immunological functions, including circulation of white blood cells, and detection of foreign material by antibodies
 
*Coagulation, the response to a broken blood vessel, the conversion of blood from a liquid to a semisolid gel to stop bleeding
 
*Messenger functions, including the transport of hormones and the signaling of tissue damage
 
*Regulation of core body temperature
 
*Hydraulic functions


==Current researches ==
==Current researches ==
Hematopoietic stem cell transplantation (HSCT) is a curative modality for a wide variety of hematologic disorders.Early survival after HSCT is dependent on the occurrence of hepatic, cardiac, and pulmonary complications.  This depictsrole of blood as origin in the formation of these organs during embryonic life as mentioned above. More research on this topic can open new avenues in field of tissue engineering.
Hematopoietic stem cell transplantation (HSCT) is a curative modality for a wide variety of hematologic disorders. Early survival after HSCT is dependent on the occurrence of hepatic, cardiac, and pulmonary complications.<ref>Kim BK, Chung KW, Sun HS, Suh JG, Min WS, Kang CS, et al. Liver disease during the first post-transplant year in bone marrow transplantation recipients: retrospective study. Bone Marrow Transplant. 2000;26:193–7</ref> This depicts the role of blood as origin in the formation of these organs during embryonic life as mentioned above. More research on this topic can open new avenues in the field of tissue engineering.
Future scope of research:  
===Future scope of research:===
Considering views about physiology of blood formation and maturation, the role of adipose tissue in marrow (saraktameda and majja), its connection with liver and spleen need to be explored. This can open a new window in treatment of diseases due to blood vitiation like skin diseases and bleeding disorders.  
Considering views about the physiology of blood formation and maturation, the role of adipose tissue in marrow (saraktameda and [[majja]]), its connection with liver and spleen need to be explored. This can open a new window in the treatment of diseases due to blood vitiation like skin diseases and bleeding disorders.  
 
===List of theses done===
===List of theses done===
1. Mohanti Krishna (2000).Critical study on Sroto-Vigyaneeyam in Bruht-trayiw.s.r. to RaktavahaStroto-Dushti and its management,Dept of Basic Principles, IPGT&RA, Jamnagar.
1. Mohanti Krishna (2000): Critical study on Sroto-Vigyaneeyam in Bruht-trayi w.s.r. to RaktavahaStroto-Dushti and its management, Dept of Basic Principles, IPGT&RA, Jamnagar.
2. Kulkarni Mayur P (2003).Concept of Dhatu-PradoshajaVikaras in Brihattrayee with the principle of management in Rakta-PradoshajaVikaras, Dept of Basic Principles, IPGT&RA, Jamnagar.
 
3. Shinde Vaishali S (2004). A study on the concept of Upadhatu in Samhitas with applied aspect to Artava-Dushti, Dept of Basic Principles, IPGT&RA, Jamnagar.  
2. Kulkarni Mayur P (2003): Concept of Dhatu-PradoshajaVikaras in Brihattrayee with the principle of management in Rakta-PradoshajaVikaras, Dept of Basic Principles, IPGT&RA, Jamnagar.
4. Kailash Chandra (2006).Applied concept of Kala and Svabhava and their role in Shonita Dusti, Dept of Basic Principles, IPGT&RA, Jamnagar.
 
5. Anil Avhad(2015). Applied study of Srotasa and SrotomulaW.S.R.to RaktavahaSrotodushtiand its management.
3. Shinde Vaishali S (2004): A study on the concept of Upadhatu in Samhitas with applied aspect to Artava-Dushti, Dept of Basic Principles, IPGT&RA, Jamnagar.  
 
4. Kailash Chandra (2006): Applied concept of Kala and Svabhava and their role in Shonita Dusti, Dept of Basic Principles, IPGT&RA, Jamnagar.
 
5. Anil Avhad(2015): Applied study of Srotasa and Srotomula w.s.r to Raktavaha Srotodushti and its management.
 
==More information ==
==More information ==
[[ VidhishonitiyaAdhyaya]]
===Related Chapters===
[[ VividhashitapitiyaAdhyaya]]  
[[ Vidhishonitiya Adhyaya]] ,[[ Vividhashitapitiya Adhyaya]],[[ Grahani Chikitsa]]
[[ GrahaniChikitsa]]
 
[Blood]
Shonitavarnaniya Adhyaya[Su. Sam. Sutra Sthana 14]
ShonitavarnaniyaAdhyaya[Su. Sam. Sutra Sthana 14]
 
=== Related articles ===
 
*[[Dhatu]]
 
*[[Rasa dhatu]]
 
*[[Mamsa dhatu]]
 
*[[Meda dhatu]]
 
*[[Asthi dhatu]]
 
*[[Majja dhatu]]
 
*[[Shukra dhatu]]
 
=== External links ===
[[Blood]]
 
=== Abbreviations ===
*SAT = Standard Ayurveda Terminology
*Cha. = Charak
*Su. = Sushruta
*Sha. =Sharangadhara
*Sa. = Samhita
 
=== References from [[Charak Samhita]] ===
 
The list of references for rakta dhatu in Charak Samhita can be seen [[Media:Rakta_dhatu-reference_list.pdf|here.]]
 
<big>'''[[Special:ContactMe|Send us your suggestions and feedback on this page.]]'''</big>
 
==References==
==References==
<div id="BackToTop"  class="noprint" style="background-color:#DDEFDD; position:fixed;
bottom:32px; left:2%; z-index:9999; padding:0; margin:0;"><span style="color:blue;
font-size:8pt; font-face:verdana,sans-serif;  border:0.2em outset #ceebf7;
padding:0.1em; font-weight:bolder; -moz-border-radius:8px; ">
[[#top| Back to the Top ]]</span></div>